"parameters" : { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625","ajaxErrorEventName":"LITHIUM:ajaxError","token":"llDklkjQYYh39PsRV29WNozos_Uk3n4rSiF573sLMnA. "context" : "envParam:feedbackData", } { "action" : "rerender" } Hast du deinen Vertrag mit Vodafone nach dem 30.September 2016 abgeschlossen, kannst du diesen per E-Mail kündigen. ] "eventActions" : [ { }, { ] // If watching, pay attention to key presses, looking for right sequence. "kudosLinksDisabled" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport.ComponentEvents.set({ { } } "event" : "QuickReply", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); }, ] "action" : "rerender" "action" : "rerender" "useTruncatedSubject" : "true", "actions" : [ }, } ] $(document).ready(function(){ ] "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" { "message" : "1969785", "}); }, "context" : "envParam:selectedMessage", { ] { }, "actions" : [ "actions" : [ "useTruncatedSubject" : "true", "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" } "context" : "envParam:selectedMessage", "actions" : [ "context" : "envParam:feedbackData", Und lies alles zu Geräterückversand, Rufnummernmitnahme und vieles mehr. "context" : "envParam:quiltName,expandedQuiltName", "event" : "MessagesWidgetCommentForm", ] var ctaHTML = ''; { { ] "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); "message" : "1969725", "action" : "rerender" { { "action" : "rerender" } "actions" : [ // Oops, not the right sequence, lets restart from the top. "context" : "envParam:quiltName", "message" : "1969785", "displayStyle" : "horizontal", { }, "context" : "", 24.12.2020 Vodafone GmbH Musterstraße 123 12345 Musterstadt hiermit kündige ich meinen Vertrag fristgerecht, hilfsweise zum nächstmöglichen Zeitpunkt. } else { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ydSzS4_pJFrDDGCOkhTk7KjQ5Zpg_CCOfMPX4O9sD_M. "context" : "envParam:quiltName,expandedQuiltName", "useTruncatedSubject" : "true", "context" : "", "event" : "removeMessageUserEmailSubscription", "actions" : [ "event" : "RevokeSolutionAction", "action" : "rerender" ] ] } else { }, { } "event" : "MessagesWidgetCommentForm", ] } }, "linkDisabled" : "false" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, { "}); }); { } // Register the click event handler "context" : "", ] "event" : "MessagesWidgetMessageEdit", "actions" : [ "selector" : "#messageview_4", "disableLabelLinks" : "false", { "context" : "", notifCount = parseInt($(this).html()) + notifCount; "eventActions" : [ "eventActions" : [ } "action" : "rerender" ] "actions" : [ } { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1969612,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] { }, "event" : "markAsSpamWithoutRedirect", '; "actions" : [ "actions" : [ "event" : "RevokeSolutionAction", { "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); var watching = false; "actions" : [ ;(function($) { "entity" : "1969785", { "actions" : [ Möchten Sie Ihren Handy-Vertrag bei Vodafone kündigen, gibt es ein paar Dinge zu beachten. { } { } { "action" : "rerender" { { { ], "context" : "", ] }, "context" : "envParam:quiltName", "actions" : [ }, } "action" : "addClassName" "kudosLinksDisabled" : "false", ] { "event" : "MessagesWidgetEditAction", "event" : "unapproveMessage", } if ( watching ) { }, { "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "QuickReply", { LITHIUM.AjaxSupport.useTickets = false; ] }, ], "useTruncatedSubject" : "true", ] }, "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { } "action" : "rerender" { "componentId" : "forums.widget.message-view", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "ProductMessageEdit", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); } { } } { { "event" : "removeThreadUserEmailSubscription", }, { { "event" : "expandMessage", if ( key == neededkeys[0] ) { "componentId" : "kudos.widget.button", "disableLabelLinks" : "false", ] }, }, } { { "action" : "rerender" "action" : "rerender" ] "useSimpleView" : "false", "selector" : "#kudosButtonV2_4", "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ { "actions" : [ { Wenn Sie Ihren Vodafone DSL-Vertrag per Briefform kündigen möchten, versenden Sie die Kündigung am besten per Einschreiben. logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ "kudosLinksDisabled" : "false", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "event" : "removeMessageUserEmailSubscription", }, "actions" : [ // console.log(key); }, "dialogContentCssClass" : "lia-panel-dialog-content", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "action" : "rerender" } } "linkDisabled" : "false" { LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }); Danke auch dafür. { ], ] "actions" : [ "actions" : [ }, } "quiltName" : "ForumMessage", }, } The owner of the contract talked to you regarding the situation and I was supposed to receive a letter from you to cancel my contract. "truncateBody" : "true", "context" : "envParam:quiltName", } "initiatorBinding" : true, "action" : "rerender" } "context" : "", { { ] }, ;(function($) { LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); { { "action" : "rerender" logmein: [76, 79, 71, 77, 69, 73, 78], { var count = 0; "action" : "rerender" { } } { { per Post oder Fax, von ihren Kunden verlangen. }, ] ] { "actions" : [ { }, "event" : "ProductAnswerComment", "}); "event" : "deleteMessage", } }, "event" : "RevokeSolutionAction", "context" : "envParam:quiltName", "action" : "rerender" "actions" : [ "action" : "rerender" }); "parameters" : { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ], var keycodes = { { LITHIUM.AjaxSupport.ComponentEvents.set({ } ] }); { } }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "revokeMode" : "true", "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "actions" : [ "entity" : "1969612", { "actions" : [ } } // console.log('watching: ' + key); ', 'ajax'); ] "action" : "rerender" { ] "action" : "rerender" { "action" : "rerender" } "actions" : [ { "context" : "", "buttonDialogCloseAlt" : "Schließen", })(LITHIUM.jQuery); ] { "event" : "MessagesWidgetEditAnswerForm", "event" : "AcceptSolutionAction", "message" : "1969785", } { } ] "initiatorBinding" : true, "context" : "envParam:selectedMessage", { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ } "action" : "rerender" ] } "action" : "rerender" } "context" : "envParam:selectedMessage", "action" : "rerender" "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1969785,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "disableKudosForAnonUser" : "false", Einige Vertragspartner bieten online kostenlose Formulare zum Kündigen an. { ] "event" : "removeThreadUserEmailSubscription", "kudosLinksDisabled" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "truncateBodyRetainsHtml" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, ] Möchtest du deinen Vertrag bei Vodafone Internet und Telefon kündigen, erfahre hier alle wichtigen Details dazu. "context" : "", { $('.css-menu').removeClass('cssmenu-open') }, ;(function($) { "linkDisabled" : "false" "initiatorDataMatcher" : "data-lia-message-uid" } LITHIUM.AjaxSupport.ComponentEvents.set({ { "forceSearchRequestParameterForBlurbBuilder" : "false", } "componentId" : "forums.widget.message-view", "actions" : [ if(1 < 1){ } "selector" : "#kudosButtonV2_3", ] "event" : "kudoEntity", ] } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:refresh_attachment_statuses","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#attachments_0_68831eae653c3a","action":"refresh_attachment_statuses","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.attachments_0:refresh_attachment_statuses?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625&t:cp=messages/contributions/messageviewparameterscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mtgi_3TOfuV4fRJ1t1r_vmr5jfuMRwQQFYPedWM-UfI. LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); var element = $(this).parent('li'); { "useTruncatedSubject" : "true", "action" : "rerender" }, }, } "action" : "rerender" "parameters" : { "parameters" : { "context" : "envParam:feedbackData", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" { ] { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Dialog({ LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); }); }, "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "AcceptSolutionAction", } "context" : "", ] ] // Reset the conditions so that someone can do it all again. "accessibility" : false, "defaultAriaLabel" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", "selector" : "#messageview_4", "showCountOnly" : "false", "actions" : [ ] var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "event" : "addThreadUserEmailSubscription", .attr('aria-expanded','true'); { ] "actions" : [ ;(function($) { } "actions" : [ } Nach der Übernahme kann sie jederzeit im Rahmen eines. "event" : "approveMessage", }, "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", { "context" : "", Provider äußert sich. } LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_68831e97c88bfc","tooltipContentSelector":"#link_68831e97c88bfc_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_68831e97c88bfc_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); count = 0; "initiatorBinding" : true, createStorage("false"); ] { "entity" : "1967270", } ] "parameters" : { "event" : "ProductMessageEdit", "useCountToKudo" : "false", }(LITHIUM.jQuery)); LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); LITHIUM.Dialog.options['-1218598225'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "actions" : [ "truncateBodyRetainsHtml" : "false", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "disallowZeroCount" : "false", "event" : "MessagesWidgetEditAction", }, "actions" : [ ] { { "actions" : [ "event" : "ProductAnswer", "showCountOnly" : "false", "context" : "envParam:selectedMessage", "useSubjectIcons" : "true", "actions" : [ "action" : "rerender" "eventActions" : [ "event" : "MessagesWidgetAnswerForm", { "context" : "", "event" : "unapproveMessage", "event" : "unapproveMessage", "actions" : [ watching = true; "quiltName" : "ForumMessage", "action" : "rerender" }, } "actions" : [ "context" : "envParam:quiltName", "actions" : [ "event" : "approveMessage", }, "quiltName" : "ForumMessage", } ] "useSimpleView" : "false", // Reset the conditions so that someone can do it all again. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "pulsate" "action" : "rerender" $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ } { } "event" : "MessagesWidgetMessageEdit", "dialogKey" : "dialogKey" "action" : "rerender" // We're good so far. "useSimpleView" : "false", ] "disableLinks" : "false", "kudosLinksDisabled" : "false", }, LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234261}); { "action" : "rerender" } ] "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "context" : "", $(document).ready(function(){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" }, LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "context" : "envParam:entity", "actions" : [ "event" : "ProductAnswer", "actions" : [ "context" : "lia-deleted-state", LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "actions" : [ }, $(document).ready(function(){ { "truncateBodyRetainsHtml" : "false", "context" : "", "event" : "MessagesWidgetEditAction", "componentId" : "forums.widget.message-view", } "event" : "AcceptSolutionAction", "initiatorDataMatcher" : "data-lia-message-uid" { "floatedBlock" : "acceptedSolutions", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ { "actions" : [ "action" : "addClassName" ] }, "action" : "rerender" }, "event" : "editProductMessage", "actions" : [ ;(function($) { "action" : "rerender" "actions" : [ "parameters" : { { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] Wir hatten einmal einen Kunden, der nach Hongkong ging und Vodafone seinen Vertrag für 6 Monate pausierte. ] ] ] "actions" : [ }); })(LITHIUM.jQuery); "eventActions" : [ ] } else { ] "actions" : [ { var position_x = msg.offset(); ] "initiatorBinding" : true, "includeRepliesModerationState" : "false", "initiatorBinding" : true, { }, { "action" : "rerender" "event" : "AcceptSolutionAction", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", { }, "initiatorDataMatcher" : "data-lia-message-uid" { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "event" : "ProductAnswer", { "action" : "rerender" "eventActions" : [ } ] "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "context" : "", { }, }, } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "showCountOnly" : "false", } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); if ( count == neededkeys.length ) { "actions" : [ "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1969725 .lia-rating-control-passive', '#form_4'); { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_68831e97c88bfc","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_68831e97c88bfc_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7e0kjDSF3ud8PF5nIsX4AOOqpjWIngiSUW5HoMSTL0s. ] "context" : "", "truncateBody" : "true", "includeRepliesModerationState" : "false", "action" : "rerender" "kudosLinksDisabled" : "false", { { "action" : "pulsate" LITHIUM.Auth.CHECK_SESSION_TOKEN = '4-HxcQNwe-xTmdAsGy3Jg964bS99Vkn-Q0SOtD98y-I. "dialogContentCssClass" : "lia-panel-dialog-content", "floatedBlock" : "acceptedSolutions", ] "initiatorDataMatcher" : "data-lia-message-uid" { { "event" : "kudoEntity", var key = e.keyCode; }, "actions" : [ setCookie: function(cookieName, cookieValue) { ] } "event" : "AcceptSolutionAction", "kudosable" : "true", }, Bist du sicher, dass du fortfahren möchtest? }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"});